PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000650225
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 229aa    MW: 25764.5 Da    PI: 10.2659
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000650225genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.9e-15956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd +l d+++ +G+g W+++ +  g++R++k+c++rw +yl
    MDP0000650225  9 KGLWTVEEDRILTDYIRVHGKGKWNRVNKVTGLKRSGKSCRLRWMNYL 56
                     678*******************************************97 PP

2Myb_DNA-binding55.31.5e-1762107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r  +++eEd+l+++++++ G++ W++Ia +++ gRt++q+k++w+++l
    MDP0000650225  62 RSDFSEEEDDLIIRLHNLIGNR-WSLIAGRVP-GRTDNQVKNHWNSHL 107
                      6789******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.804456IPR017930Myb domain
SuperFamilySSF466894.23E-307103IPR009057Homeodomain-like
SMARTSM007171.5E-12858IPR001005SANT/Myb domain
PfamPF002492.2E-13956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-211063IPR009057Homeodomain-like
CDDcd001674.50E-101256No hitNo description
PROSITE profilePS5129426.70257111IPR017930Myb domain
SMARTSM007172.9E-1661109IPR001005SANT/Myb domain
PfamPF002492.4E-1662107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-2664111IPR009057Homeodomain-like
CDDcd001675.03E-1265107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MEGGNEXKKG LWTVEEDRIL TDYIRVHGKG KWNRVNKVTG LKRSGKSCRL RWMNYLSPSV  60
KRSDFSEEED DLIIRLHNLI GNRWSLIAGR VPGRTDNQVK NHWNSHLSKK LGVGSKRGKT  120
KTKTYSDSKR AKNNFCIPSS ESNSELQPLP NSDSNSNISG DHEAAATIDG FDEEMMNIQN  180
HIGSKSEVGF CGMSEXTMMN KSHSHQDKST KINVKSERVR VQQKLPVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-2891117108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.258870.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393037.11e-145PREDICTED: transcription factor WER-like
SwissprotQ9SEI01e-65WER_ARATH; Transcription factor WER
TrEMBLM5WAK51e-104M5WAK5_PRUPE; Uncharacterized protein
STRINGVIT_17s0000g08480.t012e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.17e-67myb domain protein 66